Limba
|
APrEST88012-100ul, PrEST Antigen PBOV1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen PBOV1, Gene description: prostate and breast cancer overexpressed 1, Alternative Gene Names: UC28, UROC28, Antigen sequence: MRAFLRNQKYEDMHNIIHILQIRKLRHRLSNFPRLPGILAPETVLLPFCYKVFRKKEKVKRSQKATEFIDY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen PBOV1, Gene description: prostate and breast cancer overexpressed 1, Alternative Gene Names: UC28, UROC28, Antigen sequence: MRAFLRNQKYEDMHNIIHILQIRKLRHRLSNFPRLPGILAPETVLLPFCYKVFRKKEKVKRSQKATEFIDY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|