APrEST87805-100ul, PrEST Antigen SUV39H2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen SUV39H2, Gene description: suppressor of variegation 3-9 homolog 2 (Drosophila), Alternative Gene Names: FLJ23414, KMT1B, Antigen sequence: NTVDLEGPPSDFYYINEYKPAPGISLVNEATFGCSCTDCFFQKCCPAEAGVLLAYNKNQQIKIPPGTPI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen SUV39H2, Gene description: suppressor of variegation 3-9 homolog 2 (Drosophila), Alternative Gene Names: FLJ23414, KMT1B, Antigen sequence: NTVDLEGPPSDFYYINEYKPAPGISLVNEATFGCSCTDCFFQKCCPAEAGVLLAYNKNQQIKIPPGTPI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|