APrEST87726-100ul, PrEST Antigen PROSER1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen PROSER1, Gene description: proline and serine rich 1, Alternative Gene Names: bA50D16.2, C13orf23, FLJ12661, Antigen sequence: EQVVDLLRYFSWAEPQLKAMKALQHKMVAVQPTEVVNILNCFTFSKDKLVALELLASNIIDAQNSRPIEDLFRVNMSEKKRCKRILEQAFKGGCKAPHAM, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen PROSER1, Gene description: proline and serine rich 1, Alternative Gene Names: bA50D16.2, C13orf23, FLJ12661, Antigen sequence: EQVVDLLRYFSWAEPQLKAMKALQHKMVAVQPTEVVNILNCFTFSKDKLVALELLASNIIDAQNSRPIEDLFRVNMSEKKRCKRILEQAFKGGCKAPHAM, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|