APrEST87594-100ul, PrEST Antigen ADIPOQ Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ADIPOQ, Gene description: adiponectin, C1Q and collagen domain containing, Alternative Gene Names: ACDC, ACRP30, adiponectin, AdipoQ, apM1, GBP28, Antigen sequence: YMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen ADIPOQ, Gene description: adiponectin, C1Q and collagen domain containing, Alternative Gene Names: ACDC, ACRP30, adiponectin, AdipoQ, apM1, GBP28, Antigen sequence: YMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|