APrEST87581-100ul, PrEST Antigen SPRY1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen SPRY1, Gene description: sprouty homolog 1, antagonist of FGF signaling (Drosophila), Alternative Gene Names: hSPRY1, Antigen sequence: PRTAPRQEKHERTHEIIPINVNNNYEHRHTSHLGHAVLPSNARGPILSRSTSTGSAASSGSNSSASSEQGLLGRSPP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen SPRY1, Gene description: sprouty homolog 1, antagonist of FGF signaling (Drosophila), Alternative Gene Names: hSPRY1, Antigen sequence: PRTAPRQEKHERTHEIIPINVNNNYEHRHTSHLGHAVLPSNARGPILSRSTSTGSAASSGSNSSASSEQGLLGRSPP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|