APrEST87494-100ul, PrEST Antigen TOMM70 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen TOMM70, Gene description: translocase of outer mitochondrial membrane 70, Alternative Gene Names: KIAA0719, Antigen sequence: YTEAISLCPTEKNVDLSTFYQNRAAAFEQLQKWKEVAQDCTKAVELNPKYVKALFRRAKAHEKLDNKKECLEDVTAVCILEGFQNQQSMLLADKVLKLLGKEKAKEKYKNREPLMPSPQFIKS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen TOMM70, Gene description: translocase of outer mitochondrial membrane 70, Alternative Gene Names: KIAA0719, Antigen sequence: YTEAISLCPTEKNVDLSTFYQNRAAAFEQLQKWKEVAQDCTKAVELNPKYVKALFRRAKAHEKLDNKKECLEDVTAVCILEGFQNQQSMLLADKVLKLLGKEKAKEKYKNREPLMPSPQFIKS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|