Limba
|
APrEST87427-100ul, PrEST Antigen SUGT1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen SUGT1, Gene description: SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae), Alternative Gene Names: SGT1, Antigen sequence: EEKNEKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDMEWK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen SUGT1, Gene description: SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae), Alternative Gene Names: SGT1, Antigen sequence: EEKNEKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDMEWK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|