APrEST87421-100ul, PrEST Antigen STAM Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen STAM, Gene description: signal transducing adaptor molecule (SH3 domain and ITAM motif) 1, Alternative Gene Names: STAM1, Antigen sequence: LMVEWTDEFKNDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen STAM, Gene description: signal transducing adaptor molecule (SH3 domain and ITAM motif) 1, Alternative Gene Names: STAM1, Antigen sequence: LMVEWTDEFKNDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|