APrEST87330-100ul, PrEST Antigen RITA1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen RITA1, Gene description: RBPJ interacting and tubulin associated 1, Alternative Gene Names: C12orf52, FLJ14827, RITA, Antigen sequence: GGYRVKARTSYVDETLFGSPAGTRPTPPDFDPPWVEKANRTRGVGKEASKALGAKGSCETTPSRGSTPTLTPRKKNKYRPISHTPS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen RITA1, Gene description: RBPJ interacting and tubulin associated 1, Alternative Gene Names: C12orf52, FLJ14827, RITA, Antigen sequence: GGYRVKARTSYVDETLFGSPAGTRPTPPDFDPPWVEKANRTRGVGKEASKALGAKGSCETTPSRGSTPTLTPRKKNKYRPISHTPS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|