APrEST87244-100ul, PrEST Antigen SH3TC2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen SH3TC2, Gene description: SH3 domain and tetratricopeptide repeats 2, Alternative Gene Names: CMT4C, KIAA1985, Antigen sequence: SGQVGFVPTRNIDPDSYSPMSRNSAFLSDEERCSLLALGSDKQTECSSFLHTLARTDITSVYRLSGFESIQNPPNDLSASQP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen SH3TC2, Gene description: SH3 domain and tetratricopeptide repeats 2, Alternative Gene Names: CMT4C, KIAA1985, Antigen sequence: SGQVGFVPTRNIDPDSYSPMSRNSAFLSDEERCSLLALGSDKQTECSSFLHTLARTDITSVYRLSGFESIQNPPNDLSASQP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|