APrEST87040-100ul, PrEST Antigen CPAMD8 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen CPAMD8, Gene description: C3 and PZP-like, alpha-2-macroglobulin domain containing 8, Alternative Gene Names: K-CAP, KIAA1283, VIP, Antigen sequence: YLPSYLSLGSWYSPSQCYLQLQPPSHPLQVGEEAYFSVKSTCPCNFTLYYEVAARGNIVLSG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen CPAMD8, Gene description: C3 and PZP-like, alpha-2-macroglobulin domain containing 8, Alternative Gene Names: K-CAP, KIAA1283, VIP, Antigen sequence: YLPSYLSLGSWYSPSQCYLQLQPPSHPLQVGEEAYFSVKSTCPCNFTLYYEVAARGNIVLSG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|