APrEST87014-100ul, PrEST Antigen MICAL1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen MICAL1, Gene description: microtubule associated monooxygenase, calponin and LIM domain containing 1, Alternative Gene Names: DKFZp434B1517, FLJ11937, FLJ21739, MICAL, NICAL, Antigen sequence: LSSLNLTPDPEMEPPPKPPRSCSALARHALESSFVGWGLPVQSPQALVAMEKEEKESPFSSEEEEEDVPLDSDVEQALQTFAKTSGTMNNYPT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen MICAL1, Gene description: microtubule associated monooxygenase, calponin and LIM domain containing 1, Alternative Gene Names: DKFZp434B1517, FLJ11937, FLJ21739, MICAL, NICAL, Antigen sequence: LSSLNLTPDPEMEPPPKPPRSCSALARHALESSFVGWGLPVQSPQALVAMEKEEKESPFSSEEEEEDVPLDSDVEQALQTFAKTSGTMNNYPT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|