APrEST86571-100ul, PrEST Antigen ANKLE2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ANKLE2, Gene description: ankyrin repeat and LEM domain containing 2, Alternative Gene Names: KIAA0692, LEMD7, Antigen sequence: SETVNKERANSYKNPRTQDLTAKLRKAVEKGEEDTFSDLIWSNPRYLIGSGDNPTIVQEGCRYNVMHVAAKENQASICQLTLDVLENPDFMRLMYPDDDEAMLQKRIRYVVDLYLNTPDKMGYDTPLHFACKFGNADVVNVLSSH, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen ANKLE2, Gene description: ankyrin repeat and LEM domain containing 2, Alternative Gene Names: KIAA0692, LEMD7, Antigen sequence: SETVNKERANSYKNPRTQDLTAKLRKAVEKGEEDTFSDLIWSNPRYLIGSGDNPTIVQEGCRYNVMHVAAKENQASICQLTLDVLENPDFMRLMYPDDDEAMLQKRIRYVVDLYLNTPDKMGYDTPLHFACKFGNADVVNVLSSH, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|