Limba
|
APrEST86056-100ul, PrEST Antigen PACSIN1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen PACSIN1, Gene description: protein kinase C and casein kinase substrate in neurons 1, Alternative Gene Names: SDPI, Antigen sequence: EKQPKKAEGVALTNATGAVESTSQAGDRGSVSSYDRGQPYATEWSDDESGN, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen PACSIN1, Gene description: protein kinase C and casein kinase substrate in neurons 1, Alternative Gene Names: SDPI, Antigen sequence: EKQPKKAEGVALTNATGAVESTSQAGDRGSVSSYDRGQPYATEWSDDESGN, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|