APrEST86052-100ul, PrEST Antigen DR1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen DR1, Gene description: down-regulator of transcription 1, TBP-binding (negative cofactor 2), Alternative Gene Names: NC2, NC2-BETA, Antigen sequence: EVKEVLQECKTVALKRRKASSRLENLGIPEEELLRQQQELFAKARQQQAELAQQEWLQMQQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen DR1, Gene description: down-regulator of transcription 1, TBP-binding (negative cofactor 2), Alternative Gene Names: NC2, NC2-BETA, Antigen sequence: EVKEVLQECKTVALKRRKASSRLENLGIPEEELLRQQQELFAKARQQQAELAQQEWLQMQQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|