Limba
|
APrEST85986-100ul, PrEST Antigen EPOP Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen EPOP, Gene description: elongin BC and polycomb repressive complex 2 associated protein, Alternative Gene Names: LOC100170841, Antigen sequence: NCFPCPPALVVGEDGDLKPASSLRLQGDSK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen EPOP, Gene description: elongin BC and polycomb repressive complex 2 associated protein, Alternative Gene Names: LOC100170841, Antigen sequence: NCFPCPPALVVGEDGDLKPASSLRLQGDSK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|