APrEST85956-100ul, PrEST Antigen TIMMDC1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen TIMMDC1, Gene description: translocase of inner mitochondrial membrane domain containing 1, Alternative Gene Names: C3orf1, FLJ22597, Antigen sequence: YSGETVQERKQKDRKALHELKLEEWKGRLQVTEHLPEKIESSLQEDEPENDAKKIEALLNLPRNPSVIDKQDK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen TIMMDC1, Gene description: translocase of inner mitochondrial membrane domain containing 1, Alternative Gene Names: C3orf1, FLJ22597, Antigen sequence: YSGETVQERKQKDRKALHELKLEEWKGRLQVTEHLPEKIESSLQEDEPENDAKKIEALLNLPRNPSVIDKQDK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|