APrEST85844-100ul, PrEST Antigen IFIT1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen IFIT1, Gene description: interferon-induced protein with tetratricopeptide repeats 1, Alternative Gene Names: G10P1, GARG-16, IFI56, IFNAI1, Antigen sequence: KGQPRGQNREKLDKMIRSAIFHFESAVEKKPTFEVAHLDLARMYIEAGNH, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen IFIT1, Gene description: interferon-induced protein with tetratricopeptide repeats 1, Alternative Gene Names: G10P1, GARG-16, IFI56, IFNAI1, Antigen sequence: KGQPRGQNREKLDKMIRSAIFHFESAVEKKPTFEVAHLDLARMYIEAGNH, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|