Limba
|
APrEST85834-100ul, PrEST Antigen HAPLN4 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen HAPLN4, Gene description: hyaluronan and proteoglycan link protein 4, Alternative Gene Names: BRAL2, KIAA1926, Antigen sequence: DGSVQYPVNRPREPCGGLGGTGSAGGGGDANGGLRNYGYRHNAEERYDAFCF, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen HAPLN4, Gene description: hyaluronan and proteoglycan link protein 4, Alternative Gene Names: BRAL2, KIAA1926, Antigen sequence: DGSVQYPVNRPREPCGGLGGTGSAGGGGDANGGLRNYGYRHNAEERYDAFCF, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|