Limba
|
APrEST85819-100ul, PrEST Antigen TOB2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen TOB2, Gene description: transducer of ERBB2, 2, Alternative Gene Names: bK223H9, TOB4, TOBL, TROB2, Antigen sequence: GVASSGAGGQQPPQQPRMARSPTNSLLKHKSLS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen TOB2, Gene description: transducer of ERBB2, 2, Alternative Gene Names: bK223H9, TOB4, TOBL, TROB2, Antigen sequence: GVASSGAGGQQPPQQPRMARSPTNSLLKHKSLS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|