APrEST85611-100ul, PrEST Antigen RADIL Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen RADIL, Gene description: Ras association and DIL domains, Alternative Gene Names: FLJ10324, KIAA1849, RASIP2, Antigen sequence: YGTHFIMSPPTKSKLKRQSQLLSSMLSRTLSYKYRDLDSTFSSLGASDDPAELSTQLSAPGVLKVFGDSVCTGTHYKSVLA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen RADIL, Gene description: Ras association and DIL domains, Alternative Gene Names: FLJ10324, KIAA1849, RASIP2, Antigen sequence: YGTHFIMSPPTKSKLKRQSQLLSSMLSRTLSYKYRDLDSTFSSLGASDDPAELSTQLSAPGVLKVFGDSVCTGTHYKSVLA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|