APrEST85596-100ul, PrEST Antigen VTI1A Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen VTI1A, Gene description: vesicle transport through interaction with t-SNAREs 1A, Alternative Gene Names: MVti1, Vti1-rp2, Antigen sequence: SSRRLEAGYQIAVETEQIGQEMLENLSHDREKIQRARERLRETDANLGKSSRILTGMLRRGCSVKKQCNLSLAPK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen VTI1A, Gene description: vesicle transport through interaction with t-SNAREs 1A, Alternative Gene Names: MVti1, Vti1-rp2, Antigen sequence: SSRRLEAGYQIAVETEQIGQEMLENLSHDREKIQRARERLRETDANLGKSSRILTGMLRRGCSVKKQCNLSLAPK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|