Limba
|
APrEST85451-100ul, PrEST Antigen PINLYP Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen PINLYP, Gene description: phospholipase A2 inhibitor and LY6/PLAUR domain containing, Antigen sequence: CTASFRDKCMGPMTHCTGKENHCVSLSGHVQAGIFKPRFAMRGCATESMCFTKPGAEVPTGTNVLFLHHIECTHS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen PINLYP, Gene description: phospholipase A2 inhibitor and LY6/PLAUR domain containing, Antigen sequence: CTASFRDKCMGPMTHCTGKENHCVSLSGHVQAGIFKPRFAMRGCATESMCFTKPGAEVPTGTNVLFLHHIECTHS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|