APrEST85432-100ul, PrEST Antigen IFIT3 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen IFIT3, Gene description: interferon-induced protein with tetratricopeptide repeats 3, Alternative Gene Names: CIG-49, GARG-49, IFI60, IFIT4, IRG2, ISG60, RIG-G, Antigen sequence: HKQNGDLLQAAKCYEKELGRLLRDAPSGIGSIFLSASELEDGSEEMGQGAVSSSPRELLSNSEQL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen IFIT3, Gene description: interferon-induced protein with tetratricopeptide repeats 3, Alternative Gene Names: CIG-49, GARG-49, IFI60, IFIT4, IRG2, ISG60, RIG-G, Antigen sequence: HKQNGDLLQAAKCYEKELGRLLRDAPSGIGSIFLSASELEDGSEEMGQGAVSSSPRELLSNSEQL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|