Limba
|
APrEST85276-100ul, PrEST Antigen TLE2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen TLE2, Gene description: transducin-like enhancer of split 2, Alternative Gene Names: ESG, ESG2, FLJ41188, GRG2, Antigen sequence: SDYNLVVDEDQPSEPPSPATTPCGKVPICIPARRDLVDSPASLASSLGSP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen TLE2, Gene description: transducin-like enhancer of split 2, Alternative Gene Names: ESG, ESG2, FLJ41188, GRG2, Antigen sequence: SDYNLVVDEDQPSEPPSPATTPCGKVPICIPARRDLVDSPASLASSLGSP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|