APrEST84969-100ul, PrEST Antigen BHMG1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen BHMG1, Gene description: basic helix-loop-helix and HMG box domain containing 1, Antigen sequence: PDSCGHPRPASSSPPGDRKGGQSQLTLLDLAEDTIHCDISSCWCQGSVQDDAPFPALLAQEDVARIHFLNKTQPHPRQKLVFYDSSEDVDKGSLDADP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen BHMG1, Gene description: basic helix-loop-helix and HMG box domain containing 1, Antigen sequence: PDSCGHPRPASSSPPGDRKGGQSQLTLLDLAEDTIHCDISSCWCQGSVQDDAPFPALLAQEDVARIHFLNKTQPHPRQKLVFYDSSEDVDKGSLDADP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|