APrEST84967-100ul, PrEST Antigen MCIDAS Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen MCIDAS, Gene description: multiciliate differentiation and DNA synthesis associated cell cycle protein, Alternative Gene Names: IDAS, MCI, MCIN, Antigen sequence: ANTDTRPGNLHGAFRGLRTDCSRSALNLSHSELEEGGSFSTRIRSHSTIRTLAFPQGNAFTIRTANGGYKFRWV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen MCIDAS, Gene description: multiciliate differentiation and DNA synthesis associated cell cycle protein, Alternative Gene Names: IDAS, MCI, MCIN, Antigen sequence: ANTDTRPGNLHGAFRGLRTDCSRSALNLSHSELEEGGSFSTRIRSHSTIRTLAFPQGNAFTIRTANGGYKFRWV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|