Limba
|
APrEST84835-100ul, PrEST Antigen CFAP73 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen CFAP73, Gene description: cilia and flagella associated protein 73, Antigen sequence: FRLALQEKLSTKLPEQAEDHVPPVLRLLEKRQELVDADQALQAQKEVFRTKTAALKQRWEQLEQKERELKGSFI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen CFAP73, Gene description: cilia and flagella associated protein 73, Antigen sequence: FRLALQEKLSTKLPEQAEDHVPPVLRLLEKRQELVDADQALQAQKEVFRTKTAALKQRWEQLEQKERELKGSFI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|