APrEST84564-100ul, PrEST Antigen RIIAD1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen RIIAD1, Gene description: regulatory subunit of type II PKA R-subunit (RIIa) domain containing 1, Alternative Gene Names: C1orf230, FLJ36032, NCRNA00166, Antigen sequence: METLPGLLQRPDPGALSAAQLEQLRKFKIQTRIANEKYLRTHKEVEWLISGFFREIFLKRPDNILEFAADYFTDPRLPNKIH, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen RIIAD1, Gene description: regulatory subunit of type II PKA R-subunit (RIIa) domain containing 1, Alternative Gene Names: C1orf230, FLJ36032, NCRNA00166, Antigen sequence: METLPGLLQRPDPGALSAAQLEQLRKFKIQTRIANEKYLRTHKEVEWLISGFFREIFLKRPDNILEFAADYFTDPRLPNKIH, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|