APrEST84556-100ul, PrEST Antigen FMC1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen FMC1, Gene description: formation of mitochondrial complex V assembly factor 1 homolog, Alternative Gene Names: FMC1, HSPC268, Antigen sequence: ELHFQAATYLCLLRSIRKHVALHQEFHGKGERSVEESAGLVGLKLPHQPGGKGWEP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen FMC1, Gene description: formation of mitochondrial complex V assembly factor 1 homolog, Alternative Gene Names: FMC1, HSPC268, Antigen sequence: ELHFQAATYLCLLRSIRKHVALHQEFHGKGERSVEESAGLVGLKLPHQPGGKGWEP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|