Limba
|
APrEST84486-100ul, PrEST Antigen GSPT2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen GSPT2, Gene description: G1 to S phase transition 2, Alternative Gene Names: eRF3b, FLJ10441, Antigen sequence: TQPPTLPAGSGSNDETCTGAGYPQGKRMGRGAPVEPSREEPLVSLEGSNSAVT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen GSPT2, Gene description: G1 to S phase transition 2, Alternative Gene Names: eRF3b, FLJ10441, Antigen sequence: TQPPTLPAGSGSNDETCTGAGYPQGKRMGRGAPVEPSREEPLVSLEGSNSAVT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|