Limba
|
APrEST84259-100ul, PrEST Antigen CFAP47 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen CFAP47, Gene description: cilia and flagella associated protein 47, Antigen sequence: APPPKSPPVVIQCQSRKRAEEKVEIILNAGFFGFSLTPDLTEVLVIPKRNSHNFCEDPNEIPKIHEFEYEIQFESEAMKSKLESCVALY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen CFAP47, Gene description: cilia and flagella associated protein 47, Antigen sequence: APPPKSPPVVIQCQSRKRAEEKVEIILNAGFFGFSLTPDLTEVLVIPKRNSHNFCEDPNEIPKIHEFEYEIQFESEAMKSKLESCVALY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|