APrEST84219-100ul, PrEST Antigen FCHSD1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen FCHSD1, Gene description: FCH and double SH3 domains 1, Alternative Gene Names: FLJ00007, Antigen sequence: AHLDHYYQEELPALLKALVSELSEHLRDPLTSLSHTELEAAEVILEHAHRGEQTTSQVSWEQDLKLFLQEPGVFSPTPPQQFQPAGTDQVCVLEWG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen FCHSD1, Gene description: FCH and double SH3 domains 1, Alternative Gene Names: FLJ00007, Antigen sequence: AHLDHYYQEELPALLKALVSELSEHLRDPLTSLSHTELEAAEVILEHAHRGEQTTSQVSWEQDLKLFLQEPGVFSPTPPQQFQPAGTDQVCVLEWG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|