APrEST83997-100ul, PrEST Antigen EFCC1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen EFCC1, Gene description: EF-hand and coiled-coil domain containing 1, Alternative Gene Names: C3orf73, CCDC48, FLJ12057, Antigen sequence: SLLEEKLVDVLQLLQRLRDLNISKRALGKILLSTLDAFRDPTHEGRPSPAAILDALHQALAACQLLRRQPSAPAS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen EFCC1, Gene description: EF-hand and coiled-coil domain containing 1, Alternative Gene Names: C3orf73, CCDC48, FLJ12057, Antigen sequence: SLLEEKLVDVLQLLQRLRDLNISKRALGKILLSTLDAFRDPTHEGRPSPAAILDALHQALAACQLLRRQPSAPAS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|