APrEST83824-100ul, PrEST Antigen BLOC1S4 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen BLOC1S4, Gene description: biogenesis of lysosomal organelles complex-1, subunit 4, cappuccino, Alternative Gene Names: BCAS4L, CNO, FLJ11230, Antigen sequence: YAACLLPGAGARPEVEALDASLEDLLTRVDEFVGMLDMLRGDSSHVVSEGVPRIHAKAAEMRRIYSR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen BLOC1S4, Gene description: biogenesis of lysosomal organelles complex-1, subunit 4, cappuccino, Alternative Gene Names: BCAS4L, CNO, FLJ11230, Antigen sequence: YAACLLPGAGARPEVEALDASLEDLLTRVDEFVGMLDMLRGDSSHVVSEGVPRIHAKAAEMRRIYSR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|