Limba
|
APrEST83823-100ul, PrEST Antigen KANK3 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen KANK3, Gene description: KN motif and ankyrin repeat domains 3, Alternative Gene Names: ANKRD47, FLJ46061, Antigen sequence: QLREATTQTPWSCAEKAAQTESPAEAPSLTQESSPGSMDGDRAVAPAGILKSIMK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen KANK3, Gene description: KN motif and ankyrin repeat domains 3, Alternative Gene Names: ANKRD47, FLJ46061, Antigen sequence: QLREATTQTPWSCAEKAAQTESPAEAPSLTQESSPGSMDGDRAVAPAGILKSIMK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|