Limba
|
APrEST83806-100ul, PrEST Antigen VSIG10L Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen VSIG10L, Gene description: V-set and immunoglobulin domain containing 10 like, Antigen sequence: VLTWDVERGALISSFEIQAWPDGPALGRTSTYRDWVSLLILGPQERSAVVPLPPRNPGTWTFRILPILGGQPGTPSQSRVY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen VSIG10L, Gene description: V-set and immunoglobulin domain containing 10 like, Antigen sequence: VLTWDVERGALISSFEIQAWPDGPALGRTSTYRDWVSLLILGPQERSAVVPLPPRNPGTWTFRILPILGGQPGTPSQSRVY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|