APrEST83383-100ul, PrEST Antigen DCAF17 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen DCAF17, Gene description: DDB1 and CUL4 associated factor 17, Alternative Gene Names: C2orf37, FLJ13096, Antigen sequence: EQETFKIVDYEDELDLLSVVAVTQIDAEGKAHLDFHCNEYGTLLKSIPLVESWDVTYSHEVYFDRDLVLHIEQKPNRVFSCYVYQMICD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen DCAF17, Gene description: DDB1 and CUL4 associated factor 17, Alternative Gene Names: C2orf37, FLJ13096, Antigen sequence: EQETFKIVDYEDELDLLSVVAVTQIDAEGKAHLDFHCNEYGTLLKSIPLVESWDVTYSHEVYFDRDLVLHIEQKPNRVFSCYVYQMICD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|