APrEST83229-100ul, PrEST Antigen ST13 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ST13, Gene description: suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein), Alternative Gene Names: FAM10A1, HIP, HSPABP1, P48, SNC6, Antigen sequence: AIEINPDSAQPYKWRGKAHRLLGHWEEAAHDLALACKLDYDEDASAMLKEVQPRAQKIAEHRRKYER, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen ST13, Gene description: suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein), Alternative Gene Names: FAM10A1, HIP, HSPABP1, P48, SNC6, Antigen sequence: AIEINPDSAQPYKWRGKAHRLLGHWEEAAHDLALACKLDYDEDASAMLKEVQPRAQKIAEHRRKYER, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|