Limba
|
APrEST82926-100ul, PrEST Antigen DCAF12L2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen DCAF12L2, Gene description: DDB1 and CUL4 associated factor 12-like 2, Alternative Gene Names: WDR40C, Antigen sequence: SIAWHSEVGLPVYAHIRPRDVEAIPRASTNPSNRKVRAL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen DCAF12L2, Gene description: DDB1 and CUL4 associated factor 12-like 2, Alternative Gene Names: WDR40C, Antigen sequence: SIAWHSEVGLPVYAHIRPRDVEAIPRASTNPSNRKVRAL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|