APrEST82797-100ul, PrEST Antigen MAMSTR Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen MAMSTR, Gene description: MEF2 activating motif and SAP domain containing transcriptional regulator, Alternative Gene Names: FLJ36070, MASTR, Antigen sequence: PPGPSLWEGTDSQQPHPRMKPSPLTPCPPGVPSPSPPPHKLELQTLKLEELTVSELRQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen MAMSTR, Gene description: MEF2 activating motif and SAP domain containing transcriptional regulator, Alternative Gene Names: FLJ36070, MASTR, Antigen sequence: PPGPSLWEGTDSQQPHPRMKPSPLTPCPPGVPSPSPPPHKLELQTLKLEELTVSELRQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|