APrEST82671-100ul, PrEST Antigen FAM98C Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen FAM98C, Gene description: family with sequence similarity 98, member C, Alternative Gene Names: FLJ44669, Antigen sequence: EPGAGLRLLRFLCSELQATRLLCLRSLLDPSPRPPLGEGVVEGAGMVQELDLTLQALGLPRPAPGTPASQLLQELHA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen FAM98C, Gene description: family with sequence similarity 98, member C, Alternative Gene Names: FLJ44669, Antigen sequence: EPGAGLRLLRFLCSELQATRLLCLRSLLDPSPRPPLGEGVVEGAGMVQELDLTLQALGLPRPAPGTPASQLLQELHA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|