APrEST82292-100ul, PrEST Antigen ANKS3 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ANKS3, Gene description: ankyrin repeat and sterile alpha motif domain containing 3, Alternative Gene Names: FLJ32345, FLJ32767, KIAA1977, Antigen sequence: LNHGVKVDARDHSGATARMLAKQYGHMKIVALMDTYSPSLPKSLYRSPEKYEDLSSSDESCPAPQRQRPCRKKGVSI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen ANKS3, Gene description: ankyrin repeat and sterile alpha motif domain containing 3, Alternative Gene Names: FLJ32345, FLJ32767, KIAA1977, Antigen sequence: LNHGVKVDARDHSGATARMLAKQYGHMKIVALMDTYSPSLPKSLYRSPEKYEDLSSSDESCPAPQRQRPCRKKGVSI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|