APrEST82200-100ul, PrEST Antigen STUB1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen STUB1, Gene description: STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase, Alternative Gene Names: CHIP, HSPABP2, NY-CO-7, SDCCAG7, UBOX1, Antigen sequence: LELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen STUB1, Gene description: STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase, Alternative Gene Names: CHIP, HSPABP2, NY-CO-7, SDCCAG7, UBOX1, Antigen sequence: LELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|