Limba
|
APrEST82104-100ul, PrEST Antigen COG7 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen COG7, Gene description: component of oligomeric golgi complex 7, Antigen sequence: ISAKLTGMQNSLMMLVDTPDYSEKCVHLEALKNRLEALASPQIVAAFTSQAVDQSKVFVKVFTEIDRMPQLLAYYYKCHKVQLLAAWQELCQSDLSLDRQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen COG7, Gene description: component of oligomeric golgi complex 7, Antigen sequence: ISAKLTGMQNSLMMLVDTPDYSEKCVHLEALKNRLEALASPQIVAAFTSQAVDQSKVFVKVFTEIDRMPQLLAYYYKCHKVQLLAAWQELCQSDLSLDRQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|