Limba
|
APrEST81778-100ul, PrEST Antigen ST7 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ST7, Gene description: suppression of tumorigenicity 7, Alternative Gene Names: ETS7q, FAM4A, FAM4A1, HELG, RAY1, SEN4, TSG7, Antigen sequence: THQFPELMGVFAKAMIDIFCSAEFRDWNCKSIFMRVEDELEIPPAPQSQHFQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen ST7, Gene description: suppression of tumorigenicity 7, Alternative Gene Names: ETS7q, FAM4A, FAM4A1, HELG, RAY1, SEN4, TSG7, Antigen sequence: THQFPELMGVFAKAMIDIFCSAEFRDWNCKSIFMRVEDELEIPPAPQSQHFQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|