APrEST81717-100ul, PrEST Antigen RPRD1A Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen RPRD1A, Gene description: regulation of nuclear pre-mRNA domain containing 1A, Alternative Gene Names: FLJ10656, HsT3101, P15RS, Antigen sequence: VIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTYEQIKVDENENCSSLGSPSEPPQTL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen RPRD1A, Gene description: regulation of nuclear pre-mRNA domain containing 1A, Alternative Gene Names: FLJ10656, HsT3101, P15RS, Antigen sequence: VIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTYEQIKVDENENCSSLGSPSEPPQTL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|