Limba
|
APrEST81613-100ul, PrEST Antigen FBXL22 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen FBXL22, Gene description: F-box and leucine-rich repeat protein 22, Alternative Gene Names: Fbl22, FLJ39626, Antigen sequence: ERPSETPPAPGVSWGPPPPGAPVVISVKQEEGKQGRTGRRSHRAAPPCGFARTRVCPPTFPGADAFPQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen FBXL22, Gene description: F-box and leucine-rich repeat protein 22, Alternative Gene Names: Fbl22, FLJ39626, Antigen sequence: ERPSETPPAPGVSWGPPPPGAPVVISVKQEEGKQGRTGRRSHRAAPPCGFARTRVCPPTFPGADAFPQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|