APrEST81501-100ul, PrEST Antigen WHAMM Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen WHAMM, Gene description: WAS protein homolog associated with actin, golgi membranes and microtubules, Alternative Gene Names: KIAA1971, WHDC1, Antigen sequence: EELKVIDCVVGLQDDKNLEVKELRRQCQQLESKRGRICAKRASLRSRKDQCKENHRFRLQQAEESIRYSRQHH, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen WHAMM, Gene description: WAS protein homolog associated with actin, golgi membranes and microtubules, Alternative Gene Names: KIAA1971, WHDC1, Antigen sequence: EELKVIDCVVGLQDDKNLEVKELRRQCQQLESKRGRICAKRASLRSRKDQCKENHRFRLQQAEESIRYSRQHH, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|