APrEST81461-100ul, PrEST Antigen UACA Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen UACA, Gene description: uveal autoantigen with coiled-coil domains and ankyrin repeats, Alternative Gene Names: FLJ10128, KIAA1561, Antigen sequence: ELNKQLKDLSQKYTEVKNVKEKLVEENAKQTSEILAVQNLLQKQHVPLEQVEALKKSLNGTIENLKEELKSMQRCYEKEQQTVTKLHQLLENQKNSSVPLA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen UACA, Gene description: uveal autoantigen with coiled-coil domains and ankyrin repeats, Alternative Gene Names: FLJ10128, KIAA1561, Antigen sequence: ELNKQLKDLSQKYTEVKNVKEKLVEENAKQTSEILAVQNLLQKQHVPLEQVEALKKSLNGTIENLKEELKSMQRCYEKEQQTVTKLHQLLENQKNSSVPLA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|